PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB06G12390.1
Common NameLOC102713471
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 296aa    MW: 31048.8 Da    PI: 9.4102
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB06G12390.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.92e-19110164256
                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
      Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                   rk+ +++k+q  +Lee+F+ +++++ +++  LA++lgL  rqV vWFqNrRa+ k
  OB06G12390.1 110 RKKLRLSKDQAAVLEECFKTHSTLNPKQKVALANRLGLRPRQVEVWFQNRRARTK 164
                   678899***********************************************98 PP

2HD-ZIP_I/II125.22.9e-40110200192
   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                   +kk+rlsk+q+++LEe+F+++++L+p++Kv+la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l++en+rLeke +eLr +lk
  OB06G12390.1 110 RKKLRLSKDQAAVLEECFKTHSTLNPKQKVALANRLGLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRWCERLADENKRLEKELAELR-ALK 200
                   69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.8E-1894160IPR009057Homeodomain-like
PROSITE profilePS5007116.536106166IPR001356Homeobox domain
SuperFamilySSF466894.71E-18108175IPR009057Homeodomain-like
SMARTSM003891.5E-16108170IPR001356Homeobox domain
CDDcd000864.73E-14110167No hitNo description
PfamPF000469.3E-17110164IPR001356Homeobox domain
PRINTSPR000314.1E-5137146IPR000047Helix-turn-helix motif
PROSITE patternPS000270141164IPR017970Homeobox, conserved site
PRINTSPR000314.1E-5146162IPR000047Helix-turn-helix motif
PfamPF021836.6E-10166200IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.9E-21166209IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MMQRTMDLGL SLGLGLASQG SLSSSTTTTT SSPPGWAAAL SSIVGDVRRE AAQAAAVVGT  60
GGGGEEYGQG RASTSPDSAA ALSSASGKRE LERSGSGVDD DDGADGAGGR KKLRLSKDQA  120
AVLEECFKTH STLNPKQKVA LANRLGLRPR QVEVWFQNRR ARTKLKQTEV DCEYLKRWCE  180
RLADENKRLE KELAELRALK AAPSPASSLQ PSSAAATLTM CPSCRRVATA GAPPPNHQQC  240
HPKSNTTTTS SSPATAAAIA GANVLPSHCQ FFPAAADRTS QSTWNAAAPL VTRELF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1158166RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1051500.0AK105150.1 Oryza sativa Japonica Group cDNA clone:001-103-D07, full insert sequence.
GenBankAY2068640.0AY206864.1 Oryza sativa (indica cultivar-group) homeodomain leucine zipper protein (Hox2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006656619.10.0PREDICTED: homeobox-leucine zipper protein HOX2-like
SwissprotQ5VPE31e-115HOX2_ORYSJ; Homeobox-leucine zipper protein HOX2
SwissprotQ84U861e-115HOX2_ORYSI; Homeobox-leucine zipper protein HOX2
TrEMBLJ3MB450.0J3MB45_ORYBR; Uncharacterized protein
STRINGOB06G12390.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38423376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-43homeobox from Arabidopsis thaliana